missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212174

Invitrogen™ Human SNAIL (aa 117-167) Control Fragment Recombinant Protein

Código de producto. 30212174
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30212174 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212174

Marca: Invitrogen™ RP108418

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc finger protein SNAI1 (SNAIL)is a zinc finger transcriptional repressor which down regulates the expression of the ectodermal gene within the mesoderm and functions to form the mesoderm and neural crest. It is reported that SNAI1 acts as an important factor of tumor invasion as evidenced by its role in E-cadherin down-regulation and induction of epithelial-mesenchymal transition (EMT). In human breast cancer, the expression of SNAI1 and/or the homologous SNAI2 (Slug) has been associated with E-cadherin repression, local or distant metastasis, tumor recurrence, or poor prognosis in different tumor series. It is also reported that Snail 1 protein in the stromamay be anew putative prognosis marker for colon tumors.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O95863
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6615
Nombre Human SNAIL (aa 117-167) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI194338; dJ710H13.1; Protein sna; protein snail homolog 1; SLUGH2; SNA; Sna protein; Sna1; SNAH; snai; SNAI1; Snail; snail 1; snail 1 homolog; snail 1 zinc finger protein; snail 1, zinc finger protein; snail family transcriptional repressor 1; snail family zinc finger 1; snail homolog 1; Snail1; Zinc finger protein SNAI1
Nombre común SNAIL
Símbolo de gen Snai1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.