missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30201113

Invitrogen™ Human SMARCB1 (aa 87-184) Control Fragment Recombinant Protein

Código de producto. 30201113
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30201113 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201113

Marca: Invitrogen™ RP92347

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53764 (PA5-53764. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SWI-SNF complex is involved in the activation of transcription via the remodeling of nucleosome structure in an ATP-dependent manner. Brm (also designated SNF2alpha) and Brg-1 (also designated SNF2beta) are the ATPase subunits of the mammalian SWI-SNF complex. Brm, Brg-1, Ini1 (integrase interactor 1, also designated SNF5), BAF155 (also designated SRG3) and BAF170 are thought to comprise the functional core of the SWI-SNF complex. Addition of Ini1, BAF155 and BAF170 to Brg-1 appears to increase remodeling activity. Other complex subunits are thought to play regulatory roles. hSNF2L and hSNF2H both appear to be homologs of Drosophila ISWI, a Brm related ATPase that is present in chromatin remodeling complexes other than SWI/SNF, including the NURF (nucleosome remodeling factor).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q12824
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6598
Nombre Human SMARCB1 (aa 87-184) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AU020204; Baf47; BRG1-associated factor 47; BRG1-associated factor 47 (BAF47); CSS3; hSNF5; hSNFS; INI1; Integrase interactor 1 protein; malignant rhabdoid tumor suppressor; MRD15; mSNF5; PPP1R144; protein phosphatase 1, regulatory subunit 144; RDT; RTPS1; Sfh1p; SMARCB1; smarcb1a; SNF5; SNF5 homolog; SNF5/INI1; SNF5L1; Snr1; Sucrose nonfermenting yeast homolog like 1; sucrose nonfermenting, yeast, homolog-like 1; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 isoform a; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 A; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1-A; SWI/SNF-related matrix-associated protein; SWI10; SWNTS1; Transcription factor TYE4; Transcription regulatory protein SNF5; TYE4; Unknown (protein for MGC:138029); zgc:92517
Nombre común SMARCB1
Símbolo de gen SMARCB1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.