missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30182535

Invitrogen™ Human SLC34A1 Control Fragment Recombinant Protein

Código de producto. 30182535
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30182535

Marca: Invitrogen™ RP98434

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62358 (PA5-62358. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Renal tubular reabsorption of phosphate is critical to the maintenance of phosphate homeostasis in mammals. The brush-border membrane Na+/Pi cotransport systems in proximal tubules play a major role in this process. The renal Na(+)/P(i) cotransporter NPT2 is expressed in the brush border membrane (BBM) of proximal tubular cells. NPT2 gene expression is crucial for PTH effects on renal P(i) handling. However, renal expression of the sodium/phosphate cotransporter gene, NPT2, is not required for regulation of renal 1 alpha-hydroxylase by phosphate. NPT2 is an integral membrane protein expressed in kidney and lung. The gene encoding human NPT1 maps to chromosome 6q21.3-p23, while the gene encoding human NPT2 maps to chromosome 5q35.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q06495
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6569
Nombre Human SLC34A1 Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen FRTS2; HCINF2; Na(+)/Pi cotransporter 2 A; Na(+)-dependent phosphate cotransporter 2 A; Na/Pi cotransporter; Na+-phosphate cotransporter type II; NaPi-2; NaPi2A; naPi-2 A; NAPI-3; naPi-7; NaPi-IIa; NPHLOP1; NPT2; Npt2a; NPTIIa; renal Na+/Pi transporter; renal sodium-dependent phosphate transporter; SLC11; Slc17a2; Slc34a1; sodium/phosphate co-transporter; sodium/phosphate cotransporter 2 A; Sodium-dependent phosphate transport protein 2 A; sodium-phosphate transport protein 2 A; solute carrier family 17 (sodium phosphate), member 2; solute carrier family 17 (sodium/hydrogen exchanger) member 2; solute carrier family 17 (sodium/hydrogen exchanger), member 2; solute carrier family 34 (sodium phosphate), member 1; solute carrier family 34 (type II sodium/phosphate cotransporter), member 1; solute carrier family 34 member 1; solute carrier family 34, member 1; type IIa Na+/Pi-cotransporter
Nombre común SLC34A1
Símbolo de gen SLC34A1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado