missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC25A31 (aa 148-201) Control Fragment Recombinant Protein

Código de producto. 30200243
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30200243 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200243

Marca: Invitrogen™ RP90992

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82520 (PA5-82520. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9H0C2
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 83447
Nombre Human SLC25A31 (aa 148-201) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1700034J06Rik; Aac4; adenine nucleotide translocase 4; adenine nucleotide translocator 4; adenine nucleotide translocator), member 31; adenine nucleotide translocator), member 31-like; ADP,ATP carrier protein 4; ADP/ATP translocase 4; ANT 4; Ant4; LOC541168 protein; Sfec; SFEC35kDa; SLC25A31; solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 31-like; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31; solute carrier family 25 member 31; Sperm flagellar energy carrier protein
Nombre común SLC25A31
Símbolo de gen SLC25A31
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.