missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30198860

Invitrogen™ Human SIPA1L2 (aa 1377-1460) Control Fragment Recombinant Protein

Código de producto. 30198860
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30198860 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198860

Marca: Invitrogen™ RP94106

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55004 (PA5-55004. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Signal-induced proliferation associated-like protein 2 (SIPA1L2) is a member of the SIPA1 family of RapGAPs. Little is known of the role of the SIPA1L2 protein, but recent studies of SIPA indicate that its deregulation can cause myeloproliferative stem cell disorders in mice and increased metastases in human cancers. Other studies suggest SIPA1L1 may play important roles in embryo development and control of cell proliferation. Based on the amount of homology between SIPA family members, it is likely that SIPA1L2 plays a role in embryo development and cell proliferation, possibly including oncogenesis.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9P2F8
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 57568
Nombre Human SIPA1L2 (aa 1377-1460) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen BC058408; Kiaa0545; KIAA1389; mKIAA1389; serine-rich synapse associated protein 2; serine-rich synapse-associated protein; Sersap2; signal induced proliferation associated 1 like 2; signal-induced proliferation-associated 1 like 2; signal-induced proliferation-associated 1-like protein 2; Sipa1l2; SIPA1-like protein 2; SPA-1-like 2; SPAL2; Spar2
Nombre común SIPA1L2
Símbolo de gen SIPA1L2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDAVAETQHVLSKEDFLKLMLPD
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.