missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SHROOM2 (aa 1185-1258) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP95447
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62449 (PA5-62449. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
Especificaciones
| Q13796 | |
| Blocking Assay, Control | |
| 357 | |
| 100 μL | |
| 4832440C16; Ab2-404; apical-like protein; APX homolog of Xenopus; Apxl; C630003H05Rik; HSAPXL; liver regeneration-related protein LRRG167; protein Apxl; Protein Shroom2; Shrm2; shroom family member 2; SHROOM2 | |
| SHROOM2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SHROOM2 (aa 1185-1258) Control Fragment | |
| RUO | |
| SHROOM2 | |
| Unconjugated | |
| Recombinant | |
| PPLLIQDEDSTRIERVMDNNTTVKMVPIKIVHSESQPEKESRQSLACPAEPPALPHGLEKDQIKTLSTSEQFYS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human SHROOM2 (aa 1185-1258) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido