missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30207477

Invitrogen™ Human SHC (aa 12-157) Control Fragment Recombinant Protein

Código de producto. 30207477
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30207477 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30207477

Marca: Invitrogen™ RP95938

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81975 (PA5-81975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Skp2 (S-phase Kinase-associated Protein 2) belongs to the family of F-box proteins that interact with the Cyclin A-Cdk2 complex. Skp2 is essential for the G1-S transition in both transformed cells and diploid fibroblasts. Biochemical and genetic experiments have demonstrated that Skp2 is required for the ubiquitination and consequent degradation of p27 in cultured mammalian cells and in vitro reconstitution assays. In normal tissues, Skp2 is expressed in tonsil and placenta. In tumor tissues, Skp2 is expressed widely, in some colon, prostate, pancreas, and skin cancers, with high expression in lung, breast, ovarian, and endometrial cancers. Research suggests that Skp2 plays a role in oncogenesis, particularly in the pathogenesis of lymphomas and breast cancers.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P29353
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6464
Nombre Human SHC (aa 12-157) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen FLJ26504; OTTHUMP00000035472; p66; P66shc; RP11-307C12.1; SH2 domain protein C1; SHC; SHC (Src homology 2 domain containing) transforming protein 1; SHC (Src homology 2 domain-containing) transforming protein 1; SHC adaptor protein 1; SHC1; SHCA; SHC-transforming protein 1; SHC-transforming protein 3; SHC-transforming protein A; src homology 2 domain-containing transforming protein C1; src homology 2 domain-containing-transforming protein C1
Nombre común SHC
Símbolo de gen SHC1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.