missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SDHD (aa 22-66) Control Fragment Recombinant Protein

Código de producto. 30200477
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30200477 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200477

Marca: Invitrogen™ RP100470

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61081 (PA5-61081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mitochondrial succinate dehydrogenase complex subunit D (SDHD) is one of four proteins that make up the tricarboxylic cycle enzyme succinate dehydrogenase (SCH). Studies have shown that mutations in SDHD often leads to hereditary paragangliomas, usually benign tumors of the autonomic nervous system, suggesting that SDHD also plays a role as a tumor-suppressor gene. In one family with a nonsense mutation (R22X) in the SDHD gene, a loss of heterozygosity was found in the paragangliomas, and within these tumors the enzymatic activity of Complex II in the mitochondrial respiratory chain was completely abolished. Furthermore, high levels of angiogenic factors EPAS1 and VEGF was observed, which may stimulate tumor growth.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O14521
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6392
Nombre Human SDHD (aa 22-66) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 3110001M13Rik; AVLL5809; C78570; CBT1; CII-4; CWS3; CybS; PGL; PGL1; PRO19626; QPs3; SDH4; SDHD; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; succinate dehydrogenase complex subunit D; succinate dehydrogenase complex subunit D integral membrane protein; succinate dehydrogenase complex, subunit D, integral membrane protein; succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Nombre común SDHD
Símbolo de gen SDHD
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.