missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30200258

Invitrogen™ Human SCN7A (aa 393-476) Control Fragment Recombinant Protein

Código de producto. 30200258
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30200258 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200258

Marca: Invitrogen™ RP109304

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. George A.L. Jr., Proc. Natl. Acad. Sci. U.S.A. 89:4893-4897(1992).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q01118
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6332
Nombre Human SCN7A (aa 393-476) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1110034K09Rik; AI642000; LOW QUALITY PROTEIN: sodium channel protein type 7 subunit alpha; NaG; Na-G; Nav2; Nav2.1; Nav2.2; Nav2.3; Nax; putative voltage-gated sodium channel subunit alpha Nax; Scn6a; SCN7A; Sodium channel protein cardiac and skeletal muscle subunit alpha; sodium channel protein type 7 subunit alpha; Sodium channel protein type VII subunit alpha; sodium channel voltage-gated type VI alpha polypeptide; sodium channel voltage-gated type VII alpha; sodium channel, voltage gated, type VII alpha subunit; sodium channel, voltage-gated, type 6, alpha polypeptide; sodium channel, voltage-gated, type VI, alpha polypeptide; sodium channel, voltage-gated, type VII, alpha; sodium channel, voltage-gated, type VII, alpha subunit; sodium voltage-gated channel alpha subunit 7; voltage-dependent sodium channel alpha subunit
Nombre común SCN7A
Símbolo de gen SCN7A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.