Learn More
Invitrogen™ Human RyR3 (aa 1262-1338) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107118
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84526 (PA5-84526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
RYR3 is a ryanodine receptor, which functions to release calcium from intracellular storage for use in many cellular processes. RYR3 is involved in skeletal muscle contraction by releasing calcium from the sarcoplasmic reticulum followed by depolarization of T-tubules. Two transcript variants encoding different isoforms of RYR3 have been found. RYR3 mediates calcium channel release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm in muscle and plays a role in triggering muscle contraction. Further, RYR3 may also regulate Ca(2+) release by other calcium channels, as well as Ca(2+) release from the endoplasmic reticulum in non-muscle cells. RYR3 also contributes to cellular calcium ion homeostasis. Plays a role in cellular calcium signaling. Diseases associated with RYR3 include Central Core Disease and Arrhythmogenic Right Ventricular Dysplasia 2.
Especificaciones
Q15413 | |
Blocking Assay, Control | |
6263 | |
100 μL | |
AI851294; Brain ryanodine receptor-calcium release channel; brain-type ryanodine receptor; C230090H21; calcium release channel; HBRR; Ryanodine receptor 3; RYR3; RYR-3; Type 3 ryanodine receptor | |
RYR3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RyR3 (aa 1262-1338) Control Fragment | |
RUO | |
RyR3 | |
Unconjugated | |
Recombinant | |
TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.