missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human RyR3 (aa 1262-1338) Control Fragment Recombinant Protein Código de producto.: 30196896

Invitrogen™ Human RyR3 (aa 1262-1338) Control Fragment Recombinant Protein

Código de producto. 30196896
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196896

Marca: Invitrogen™ RP107118

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84526 (PA5-84526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RYR3 is a ryanodine receptor, which functions to release calcium from intracellular storage for use in many cellular processes. RYR3 is involved in skeletal muscle contraction by releasing calcium from the sarcoplasmic reticulum followed by depolarization of T-tubules. Two transcript variants encoding different isoforms of RYR3 have been found. RYR3 mediates calcium channel release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm in muscle and plays a role in triggering muscle contraction. Further, RYR3 may also regulate Ca(2+) release by other calcium channels, as well as Ca(2+) release from the endoplasmic reticulum in non-muscle cells. RYR3 also contributes to cellular calcium ion homeostasis. Plays a role in cellular calcium signaling. Diseases associated with RYR3 include Central Core Disease and Arrhythmogenic Right Ventricular Dysplasia 2.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q15413
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6263
Nombre Human RyR3 (aa 1262-1338) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI851294; Brain ryanodine receptor-calcium release channel; brain-type ryanodine receptor; C230090H21; calcium release channel; HBRR; Ryanodine receptor 3; RYR3; RYR-3; Type 3 ryanodine receptor
Nombre común RyR3
Símbolo de gen RYR3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human RyR3 (aa 1262-1338) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado