missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ROCK1 (aa 1276-1305) Control Fragment Recombinant Protein

Código de producto. 30182340
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30182340 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30182340 Proveedor Invitrogen™ N.º de proveedor RP99615

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ROCK1 is a serine/threonine kinase that regulates cell differentiation and migration. The Rho/ROCK pathway is involved in the progression of various human cancers. ROCK1 has been found to be a new Caspase-3 substrate. ROCK, one of the effectors of the small GTPase Rho, has recently been shown to contribute significantly to myosin light chain (MLC) activation through two pathways: direct phosphorylation of MLC and phosphorylation of MLC phosphatase, leading to its inhibition. The increase in cellular contractility that is necessary for apoptotic membrane blebbing implies sustained augmentation of MLC phosphorylation. ROCK-1 consists of an amino-terminal kinase domain and an inhibitory cysteine/histidine-rich C-terminal domain that is located within a pleckstrin-homology region. They are joined by a variable region that contains the Rho-binding domain. During apoptosis, ROCK-I is cleaved by caspase-3 at a conserved DETD1113/G sequence and its carboxy-terminal inhibitory domain is removed, resulting in deregulated and constitutive kinase activity. The caspase-3-mediated cleavage and activation of ROCK I induces phosphorylation of MLC and membrane blebbing, one of the first events in the execution phase of apoptosis.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q13464
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6093
Nombre Human ROCK1 (aa 1276-1305) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1110055K06Rik; Ac2-154; Liver regeneration-related protein LRRG199; MGC131603; MGC43611; p150 RhoA-binding kinase ROK beta; p160 ROCK-1; p160ROCK; p160-ROCK; PRO0435; Renal carcinoma antigen NY-REN-35; Rho associated coiled-coil containing protein kinase 1; Rho kinase; Rho-associated coiled-coil containing protein kinase 1; Rho-associated coiled-coil forming kinase 1; Rho-associated kinase beta; rho-associated protein kinase 1; Rho-associated, coiled-coil containing protein kinase 1; rho-associated, coiled-coil-containing protein kinase 1; Rho-associated, coiled-coil-containing protein kinase I; ROCK1; ROCK-I
Nombre común ROCK1
Símbolo de gen Rock1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KEDLICPCKVSYDVTSARDMLLLACSQDEQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.