missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30206867

Invitrogen™ Human RhoBTB1 (aa 368-442) Control Fragment Recombinant Protein

Código de producto. 30206867
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30206867

Marca: Invitrogen™ RP97009

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111119 (PA5-111119. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RHOBTB1 (Rho-related BTB domain-containing protein 1) and RHOBTB3 (Rho-related BTB domain-containing protein 3) each contain two BTB (POZ) domains and belong to the RhoBTB subfamily of Rho GTPases. Members of the RhoBTB subfamily are evolutionarily conserved and are characterized by a proline-rich region, a GTPase domain and two tandem BTB repeats. While both RHOBTB1 and RHOBTB3 are expressed ubiquitously, RHOBTB1 is found at high levels in placenta, stomach, testis, kidney and skeletal muscle, whereas RHOBTB3 is found at high levels in neural and cardiac tissues. RHOBTB1 is thought to play a role in GTPase-mediated signaling and may participate in organization of the Actin filament system. Additionally, RHOBTB1 expression is decreased in head and neck carcinomas, suggesting a possible role for RHOBTB1 as a tumor suppressor.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O94844
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9886
Nombre Human RhoBTB1 (aa 368-442) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1700008H16Rik; 3110048G13Rik; AI173445; AI573858; AV350930; DBC2; KIAA0717; KIAA0740; MGC33059; MGC33841; p83; Rho related BTB domain containing 1; Rhobtb1; RHOBTB2; Rho-related BTB domain containing 1; rho-related BTB domain-containing protein 1; zmp:0000000868
Nombre común RhoBTB1
Símbolo de gen RHOBTB1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYTGQLDEKEKDLVGLAQIAEVLEM
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.