missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30197347

Invitrogen™ Human RAD9 (aa 56-170) Control Fragment Recombinant Protein

Código de producto. 30197347
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197347

Marca: Invitrogen™ RP106175

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAD9 is a component of the 9-1-1 cell cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesions upon damage by the RAD17-replication factor C clamp loader complex. RAD9 acts as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q99638
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 5883
Nombre Human RAD9 (aa 56-170) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Cell cycle checkpoint control protein RAD9A; chromatin-binding protein RAD9; DNA repair exonuclease rad9 homolog A; DNA repair protein RAD9; hRAD9; mRAD9; QtsA-19913; Rad9; RAD9 checkpoint clamp component A; RAD9 homolog A; RAD9 homolog A (S. pombe); Rad9a; Rad9-like protein; rCG47324-like; unnamed protein product; YD9934.02 C; YDR217C
Nombre común RAD9
Símbolo de gen RAD9A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LFFQQYQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGI
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.