missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PUF60 (aa 328-410) Control Fragment Recombinant Protein

Código de producto. 30202915
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30202915 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202915

Marca: Invitrogen™ RP104013

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84100 (PA5-84100. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PUF60 encodes a protein that is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UHX1
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 22827
Nombre Human PUF60 (aa 328-410) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2410104I19Rik; 2810454F19Rik; 60 kDa poly(U)-binding-splicing factor; FBP interacting repressor; FBP-interacting repressor; FIR; FLJ31379; FUSE-binding protein-interacting repressor; LOW QUALITY PROTEIN: poly(U)-binding-splicing factor PUF60; poly(U) binding splicing factor 60; poly(U) binding splicing factor 60 KDa; poly(U)-binding-splicing factor PUF60; poly-U binding splicing factor 60; poly-U binding splicing factor 60 K; poly-U binding splicing factor 60 KDa; PUF60; pyrimidine tract binding splicing factor; RNA-binding protein Siah-BP; Ro ribonucleoprotein-binding protein 1; Ro-binding protein 1; RoBP1; ROBPI; Siah binding protein 1; siah binding protein 1; FBP interacting repressor; pyrimidine tract binding splicing factor; Ro ribonucleoprotein-binding protein 1; siah-binding protein 1; SIAHBP1; Siah-BP1; similar to fuse-binding protein-interacting repressor isoform a; VRJS
Nombre común PUF60
Símbolo de gen Puf60
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia AATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.