missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30208019

Invitrogen™ Human PTER (aa 130-200) Control Fragment Recombinant Protein

Código de producto. 30208019
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30208019 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208019

Marca: Invitrogen™ RP97145

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58226 (PA5-58226. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PTER is a mammalian homolog to bacterial phosphotriesterases, enzymes that hydrolyze phosphotriester-containing organophosphate pesticides. It is expressed primarily in the proximal renal tubules and the gene has been localized in humans to chromosomal band 10p12 by in situ hybridization. PTER, in addition to FTO, MC4R, and NPC1 has recently been shown to be a new risk loci for early-onset and morbid adult obesity in European populations. At least two isoforms of PTER are known to exist.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96BW5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9317
Nombre Human PTER (aa 130-200) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI790318; HPHRP; Mpr56-1; Parathion hydrolase-related protein; phosphotriesterase related; phosphotriesterase-related protein; Pter; resiniferatoxin-binding phosphotriesterase-related protein; resiniferatoxin-binding, phosphotriesterase-related; resiniferatoxin-binding, phosphotriesterase-related protein; resiniferotoxin-binding phosphotriesterase-related protein; Rpr1; Rpr-1
Nombre común PTER
Símbolo de gen PTER
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia DATHSSETRAMSVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVII
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.