missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PSMB6 (aa 101-150) Control Fragment Recombinant Protein

Código de producto. 30213501
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30213501 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30213501

Marca: Invitrogen™ RP105268

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signaling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Other proteins are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (∽31), barrel-shaped molecular machine with an apparent molecular weight of ∽2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. The PA28/11S REG Activator protein complex functions as a proteolytic activator. This complex, consisting of alpha, beta, and gamma subunits, enhances the activity of the 20S proteolytic core. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis (CF transmembrane regulator), Angelmane's syndrome (E6-AP), and Liddle syndrome (endothelial sodium channels).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P28072
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 5694
Nombre Human PSMB6 (aa 101-150) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen DELTA; Lmp19; LMPY; low molecular mass protein 19; Macropain delta chain; Mpnd; multicatalytic endopeptidase complex delta chain; proteasome (prosome, macropain) subunit, beta type 6; proteasome (prosome, macropain) subunit, beta type, 6; proteasome 20 S subunit beta 6; proteasome beta 6 subunit; proteasome catalytic subunit 1; proteasome chain 5; Proteasome delta chain; proteasome subunit beta 6; proteasome subunit beta type-6; proteasome subunit delta; proteasome subunit Y; Psmb6; Psmb6l; PSY large multifunctional protease Y; RP23-122P1.4; subunit 2; Y
Nombre común PSMB6
Símbolo de gen PSMB6
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.