missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30199231

Invitrogen™ Human PRPF3 (aa 173-261) Control Fragment Recombinant Protein

Código de producto. 30199231
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30199231 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30199231

Marca: Invitrogen™ RP107545

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66896 (PA5-66896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors. PRPF3 is 1 of several proteins that associate with U4 and U6 snRNPs. The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors. PRPF3 is 1 of several proteins that associate with U4 and U6 snRNPs.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O43395
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9129
Nombre Human PRPF3 (aa 173-261) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 3632413F13Rik; HPRP3; HPRP3P; MGC137653 protein; pre-mRNA processing factor 3; pre-mRNA-splicing factor 3; PRP3; PRP3 pre-mRNA processing factor 3 homolog; PRP3 pre-mRNA processing factor 3 homolog (yeast); Prp3p; PRPF3; RP18; SNRNP90; U4/U6 small nuclear ribonucleoprotein Prp3; U4/U6 snRNP 90 kDa protein; U4/U6-associated RNA splicing factor
Nombre común PRPF3
Símbolo de gen PRPF3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.