missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30203633

Invitrogen™ Human Protein S (aa 458-581) Control Fragment Recombinant Protein

Código de producto. 30203633
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30203633 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30203633

Marca: Invitrogen™ RP100455

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110737 (PA5-110737. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein S is a vitamin K-dependent, potent neutral anticoagulant plasma glycoprotein. Protein S has a molecular weight of approximately 70 kDa and consists of a single polypeptide chain. The concentration of protein S in human plasma is 25 μg/mL, with a half-life of approximately two days. About 40% of Protein S in plasma is in a free form, whereas 60% is complexed with C4b-binding Protein (C4BP). Only the free Protein S functions as a cofactor to antigen presenting cells (APC) in the APC-dependent degradation of Factor Va and Factor VIIIa.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P07225
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 5627
Nombre Human Protein S (aa 458-581) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AW214361; Preproprotein S; PROS; PROS 1; PROS1; protein S; protein S (alpha); Protein S alpha; protein Sa; proteinS; PS 21; PS 22; PS 23; PS 24; PS 25; PS 26; PS21; PS22; PS23; PS24; PS25; PS26; PSA; rabbit protein S; THPH5; THPH6; unnamed protein product; vitamin K-dependent plasma protein S; vitamin K-dependent protein S; vitamin K-dependent protein S precursor
Nombre común Protein S
Símbolo de gen PROS1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.