missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PPP2R3A (aa 1065-1150) Control Fragment Recombinant Protein

Código de producto. 30213325
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30213325

Marca: Invitrogen™ RP96286

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57415 (PA5-57415. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B'/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holoenzyme. The product of this gene belongs to the B' family. The B' family has been further divided into subfamilies. The product of this gene belongs to the alpha subfamily of regulatory subunit B'. Alternative splicing results in multiple transcript variants encoding different isoforms.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q06190
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 5523
Nombre Human PPP2R3A (aa 1065-1150) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 3222402P14Rik; A730042E07; DNA for thyroid hormone receptor binding site (258 bp); PP2A subunit B isoform PR72/PR130; PP2A subunit B isoform R3 isoform; PP2A subunit B isoforms B72/B130; PP2A subunit B isoforms B''-PR72/PR130; PP2A, subunit B, R3 isoform; PPP2R3; PPP2R3A; PR130; PR72; protein phosphatase 2 (formerly 2 A), regulatory subunit B'' (PR 72), alpha isoform and (PR 130), beta isoform; protein phosphatase 2 (formerly 2 A), regulatory subunit B'', alpha; protein phosphatase 2 regulatory subunit B'', alpha; protein phosphatase 2 regulatory subunit B''alpha; protein phosphatase 2, regulatory subunit B'', alpha; serine/threonine-protein phosphatase 2 A 72/130 kDa regulatory subunit B; Serine/threonine-protein phosphatase 2 A regulatory subunit B'' subunit alpha; Serine/threonine-protein phosphatase 2 A regulatory subunit B'' subunit alpha-like protein
Nombre común PPP2R3A
Símbolo de gen PPP2R3A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado