missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30194901

Invitrogen™ Human POLH (aa 417-529) Control Fragment Recombinant Protein

Código de producto. 30194901
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30194901 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194901

Marca: Invitrogen™ RP89494

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52332 (PA5-52332. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The XPA gene encodes a zinc metalloprotein that preferentially binds to DNA damaged by UV radiation and chemical carcinogens and is required for the incision step during nucleotide excision repair The XPB and XPD genes encode DNA helicases involved in several DNA metabolic pathways, including DNA repair and transcription, and the XPG gene product is an endonuclease that cuts on the 3' side of a DNA lesion during nucleotide excision repair. Molecular defects in the XP variant (POL H) group maintain normal excision repair, yet they result in a substantial reduction in the ability to synthesize intact daughter DNA strands during DNA replication following DNA damage.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9Y253
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 5429
Nombre Human POLH (aa 417-529) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen DNA polymerase eta; DNA-directed DNA polymerase eta; FLJ16395; FLJ21978; Polh; polymerase (DNA directed), eta; polymerase (DNA directed), eta (RAD 30 related); polymerase (DNA) eta; RAD30; RAD30 homolog A; RAD30A; Xeroderma pigmentosum variant type protein; xeroderma pigmentosum variant type protein homolog; XP V; XPV; XP-V
Nombre común POLH
Símbolo de gen POLH
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.