missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30180533

Invitrogen™ Human PLLP (aa 1-35) Control Fragment Recombinant Protein

Código de producto. 30180533
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30180533 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30180533

Marca: Invitrogen™ RP98551

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plasmolipin is an 18 kDa membrane-bound proteolipid that belongs to the tetraspan (4TM) family, a rapidly growing group of myelin-associated proteins. Many of these proteins could be linked to human hereditary demyelinating neuropathies. Studies indicate that plasmolipin is a component of the cytoskeletal structure and has been localized to the apical surface of tubular epithelial cells. It has been shown that, upon addition to lipid bilayers, plasmolipin induces formation of ion channels that are both voltage-dependent and potassium-specific. Plasmolipin was originally isolated from kidney tissue. Subsequently, it has been shown to be widely expressed, not only being present in kidney, but also in the nervous system, thymus, testis, lung, and thyroid gland.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9Y342
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 51090
Nombre Human PLLP (aa 1-35) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 0610010I06Rik; AV001002; Plapi; Plasma membrane proteolipid; plasma membrane proteolipid (plasmolipin); plasmolipin; PLLP; PMLP; Tm4sf11; transmembrane 4 superfamily member 11; transmembrane 4 superfamily member 11 (plasmolipin)
Nombre común PLLP
Símbolo de gen PLLP
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.