missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PLEKHG1 (aa 600-685) Control Fragment Recombinant Protein

Código de producto. 30196928
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30196928 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196928

Marca: Invitrogen™ RP105771

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65005 (PA5-65005. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLEKHG1 gene ontology annotations related to this gene include regulation of Rho protein signal transduction.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9ULL1
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 57480
Nombre Human PLEKHG1 (aa 600-685) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ARHGEF41; KIAA1209; pleckstrin homology and RhoGEF domain containing G1; pleckstrin homology domain containing, family G (with RhoGef domain) member 1; pleckstrin homology domain-containing family G member 1; PLEKHG1
Nombre común PLEKHG1
Símbolo de gen PLEKHG1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SSGHRIVRRASSAGESNTCPPEIGTSDRTRELQNSPKTEGQEEMTPFGSSIELTIDDIDHVYDNISYEDLKLMVAKREEAESTPSK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.