missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PLCD4 (aa 90-164) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP102813
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58264 (PA5-58264. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the delta class of phospholipase C enzymes. Phospholipase C enzymes play a critical role in many cellular processes by hydrolyzing phosphatidylinositol 4,5-bisphosphate into two intracellular second messengers, inositol 1,4,5-trisphosphate and diacylglycerol. Expression of this gene may be a marker for cancer.
Especificaciones
| Q9BRC7 | |
| Blocking Assay, Control | |
| 84812 | |
| 100 μL | |
| 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4; 4921507K24Rik; hPLCD4; phosphoinositide phospholipase C delta-4; phosphoinositide phospholipase C-delta-4; phospholipase C delta 4; phospholipase C, delta 4; phospholipase C-delta-4; PLC delta4; Plcd; PLCD4; PLC-delta-4 | |
| Plcd4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PLCD4 (aa 90-164) Control Fragment | |
| RUO | |
| PLCD4 | |
| Unconjugated | |
| Recombinant | |
| GFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLH | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human PLCD4 (aa 90-164) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido