missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30208305

Invitrogen™ Human PLAA (aa 495-584) Control Fragment Recombinant Protein

Código de producto. 30208305
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30208305 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208305

Marca: Invitrogen™ RP92984

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54299 (PA5-54299. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phospholipase A-2-activating protein (PLAA), also named PLAP, can interact with ubiquitin and is involved in the maintenance of ubiquitin levels. PLAA contains multiple consensus domains including WD repeats, PFU domain and PUL domain. Although the function of PLAA remains unclear, ubiquitin binding of PLAA might be the central role that connects ubiquitination and degradation in ERAD. Recent finding revealed that PLAA served as a novel nociceptive mediator after incision, and its expression level is regulated by miR-203.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9Y263
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9373
Nombre Human PLAA (aa 495-584) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2410007N06; AI536418; AU018445; AW208417; D4Ertd618e; DOA1; DOA1 homolog; phospholipase A2 activating protein; phospholipase A2, activating protein; phospholipase A-2-activating protein; phospholipase A2-activating protein; PLA2P; Plaa; PLAP; Ufd3
Nombre común PLAA
Símbolo de gen Plaa
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEAVTFDQANPTQILGKLKELNGTAPEEKKLTEDDLILLEKILSLIC
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.