missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Periostin (aa 193-326) Control Fragment Recombinant Protein

Código de producto. 30208645
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30208645 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208645

Marca: Invitrogen™ RP89721

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82458 (PA5-82458. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Periostin (PN), also designated osteoblast-specific factor 2 (OSF-2), is a disulfide linked protein originally isolated as a osteoblast-specific factor. Periostin is a secreted protein that binds heparin and functions as a ligand for alpha(V)beta(3) and alpha(V)beta(5) integrins. In preosteoblasts, Periostin acts as a cell adhesion molecule and plays a role in osteoblast recruitment, spreading and attachment. Periostin is mainly detected in lower gastrointestinal tract, aorta, stomach, placenta, uterus and breast tissues but is up-regulated in epithelial ovarian tumors and overexpressed in breast cancer. Expression of Periostin is increased by bone morphogenetic protein (BMP2) and transforming growth factor beta 1(TGF beta 1). Periostin contains a typical signal sequence, followed by a cysteine-rich domain, a fourfold repeated domain, which shows homology with the insect protein fasciclin, and a C-terminal domain.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q15063
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10631
Nombre Human Periostin (aa 193-326) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen A630052E07Rik; AI747096; fasciclin I-like; Fasciclin-I like; LOW QUALITY PROTEIN: periostin; MGC119510; MGC119511; OSF 2; Osf2; OSF-2; osteoblast specific factor 2; osteoblast specific factor 2 (fasciclin I-like); osteoblast-specific factor 2; PDLPOSTN; peri; periodontal ligament-specific periostin; periostin; periostin variant 1; periostin variant 2; periostin variant 3; periostin variant 4; periostin variant 5; periostin variant 6; periostin variant 7; periostin variant 8; periostin variant 9; periostin, osteoblast specific factor; periostin-like factor; Plf; PN; POSTN; POSTN protein; RP11 412K4.1; RP11-412K4.1
Nombre común Periostin
Símbolo de gen Postn
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.