missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDGF-D (aa 121-193) Control Fragment Recombinant Protein

Código de producto. 30194277
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194277

Marca: Invitrogen™ RP106112

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (%), Rat (%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The platelet-derived growth factor (PDGF) family consists of four members; PDGF-A, PDGF-B, PDGF-C and PDGF-D (spinal cord-derived growth factor-B or iris-expressed growth factor). PDGF members form disulphide-bonded dimeric isoforms, which are important for growth, survival and function in several types of connective tissue cells. Their biological effects are mediated via two tyrosine kinase receptors, PDGFR-a and PDGFR-b, and PDGF-mediated signaling is critical for development of many organ systems. PDGF-D has a two-domain structure similar to PDGF-C and is secreted as a disulphide-linked homodimer, PDGF-DD. PDGF-D induces cellular transformation and promotes tumor growth by accelerating the proliferation rate of tumor cells and by stimulation of tumor neovascularization. PDGF-D may play a role in the development of brain tumors. The potential oncogenic activity of PDGF-DD may be important for the development and/or progression of prostate cancer. PDGF-D is expressed in fibroblastic adventitial cells, cultured endothelial cells and in a variety of tumor cell lines including those derived from ovarian, renal and lung cancers, as well as from astrocytomas and medulloblastomas. PDGF-D is expressed in the human kidney.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9GZP0
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 80310
Nombre Human PDGF-D (aa 121-193) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1110003I09Rik; Iegf; Iris-expressed growth factor; MSTP036; Pdgfd; PDGF-D; PDGFD latent form; PDGFD receptor-binding form; platelet derived growth factor D; platelet-derived growth factor D; Platelet-derived growth factor D, latent form; Platelet-derived growth factor D, receptor-binding form; platelet-derived growth factor, D polypeptide; rSCDGF-B; SCDGFB; SCDGF-B; spinal cord derived growth factor B; spinal cord-derived growth factor B; spinal cord-derived growth factor-B; spinal-cord derived growth factor-B protein; UNQ1899/PRO4345
Nombre común PDGF-D
Símbolo de gen Pdgfd
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado