missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30213305

Invitrogen™ Human PAR4 (aa 215-330) Control Fragment Recombinant Protein

Código de producto. 30213305
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30213305 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30213305

Marca: Invitrogen™ RP89408

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96IZ0
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 5074
Nombre Human PAR4 (aa 215-330) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2310001G03Rik; coagulation factor II (thrombin) receptor-like 3; Coagulation factor II receptor-like 3; F2R like thrombin/trypsin receptor 3; F2RL3; PAR4; Par-4; par-4 induced by effectors of apoptosis; Pawr; PRKC apoptosis WT1 regulator protein; PRKC, apoptosis, WT1, regulator; pro-apoptotic WT1 regulator; prostate apoptosis response 4; prostate apoptosis response 4 protein; Prostate apoptosis response protein 4; prostate apoptosis response protein PAR-4; prostate apoptosis response-4; protease-activated receptor-4; proteinase-activated receptor 4; Thrombin receptor-like 3; transcriptional repressor PAR4; transcriptional repressor Par-4-like protein PAWR; WT1-interacting protein
Nombre común PAR4
Símbolo de gen Pawr
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.