missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30208082

Invitrogen™ Human PAPPA2 (aa 114-225) Control Fragment Recombinant Protein

Código de producto. 30208082
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208082

Marca: Invitrogen™ RP91867

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53793 (PA5-53793. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLAC3 (placenta-specific protein 3), also known as PAPP-A2, is a metalloproteinase that cleaves the insulin-like growth factor-binding protein (IGFBP)-5 in a IGF-independent fashion. It has been suggested that the cleavage of IGFBP-5 and to a lesser extent IGFBP-3 produced in the maternal decidua promotes feto-placental growth. Recent studies have shown elevated levels of PLAC3 in hypertensive disorders of pregnancy including preeclampsia and HELLP (hemolysis, elevated liver enzymes, and low platelets) syndrome.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9BXP8
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 60676
Nombre Human PAPPA2 (aa 114-225) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen LOC680415; PAPPA2; PAPP-A2; pappalysin 2; pappalysin-2; Pappe; PAPP-E; PLAC3; placenta-specific 3; pregnancy-associated plasma preproprotein-A2; Pregnancy-associated plasma protein A2; Pregnancy-associated plasma protein E1; pregnancy-associated plasma protein-E; RP4-774I24.1; similar to pappalysin 2 isoform 1
Nombre común PAPPA2
Símbolo de gen PAPPA2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia NPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTLNEPKPETQRRGWAKSRQRRQVWKRRAEDGQGDSGISSHFQPWPKH
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado