missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Pannexin 2 (aa 318-408) Control Fragment Recombinant Protein

Código de producto. 30196469
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30196469 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30196469 Proveedor Invitrogen™ N.º de proveedor RP95377

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gap junctions are channel-forming structures that allow direct metabolic and electrical communication between adjacent cells of almost all types in mammalian tissues. In the human body, they are absent only in adult skeletal muscle cells and some circulating blood cells. A gap junction is formed two hemichannels, one in each of the neighboring cells, composed of six subunits. In mice and humans, at least 20 connexin and 3 pannexin genes encode gap junction proteins. Connexins are only found in chordates, while pannexins are present in both chordate and invertebrate genomes. Pannexins, previously known as innexins, are predicted to have four transmembrane regions, two extracellular loops, one intracellular loop, and intracellular N- and C-termini. Both human and mouse genomes contain three pannexin-encoded genes. Pannexin 2 (Px2, PANX2) appears to be a brain specific gene, and is abundantly expressed in the central nervous system, as is pannexin 1. In many neuronal cell populations, including hippocampus, olfactory bulb, cortex, and cerebellum, pannexin 1 and pannexin 2 are co-expressed; in other brain regions such as white matter, only pannexin 1-positive cells are found.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96RD6
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 56666
Nombre Human Pannexin 2 (aa 318-408) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen h PX2; hPANX2; pannexin 2; pannexin-2; PANX2; Px2; si:ch211-192n14.2
Nombre común Pannexin 2
Símbolo de gen PANX2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.