missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PAI1 (aa 210-329) Control Fragment Recombinant Protein

Código de producto. 30181207
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30181207 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30181207

Marca: Invitrogen™ RP99380

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PAI1 (plasminogen activator inhibitor 1) belongs to serine protease inhibitor superfamily, and is the principal inhibitor of tissue-type and urokinase-type plasminogen activators (tPA and uPA). Platelets are the main source of the circulating PAI11, but it is synthesized and secreted by many tissue and cell types, including fibroblasts, smooth muscle cells, endothelial cells, hepatocytes, and inflammatory cells. Expression of PAI11 can be regulated at the transcriptional level by many factors including growth factors, cytokines, hormones, inflammatory factors, glucose or lipid metabolites, vascular tone regulating factors, chemicals, and other environmental or physical factors. PAI1 is present at increased levels in various disease states, and has been linked to an increased occurrence of thrombosis in obesity, thrombophilia and the metabolic syndrome. Defects in PAI-1 are characterized by abnormal bleeding. PAI1 mediates inhibition of fibrinolysis by inhibiting the activity of plasminogen activator, and may promote neuronal survival. Other defects in PAI1 are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1 deficiency). Alternatively spliced transcript variants encoding different isoforms of PAI1 have been found.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P05121
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 5054
Nombre Human PAI1 (aa 210-329) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Endothelial plasminogen activator inhibitor; nexin, plasminogen activator inhibitor type 1; PAI; PAI1; PAI-1; PAI1 protein; PAI1A; Pai1aa; Planh; Planh1; plas; plasminogen activator inhibitor; plasminogen activator inhibitor 1; plasminogen activator inhibitor I; plasminogen activator inhibitor, type I; plasminogen activator inhibitor-1; Plasminogen activator inhibitor-1 precursor (PAI-1) (Endothelial plasminogen activator inhibitor) (PAI); putative plasminogen activator inhibitor-1; RATPAI1A; serine (or cysteine) peptidase inhibitor, clade E, member 1; serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1; serine (or cysteine) proteinase inhibitor, clade E, member 1; serine (or cysteine) proteinase inhibitor, member 1; serpin E1; serpin family E member 1; serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1; SERPINE1; SERPINE-1
Nombre común PAI1
Símbolo de gen Serpine1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.