missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human P-Selectin Control Fragment Recombinant Protein

Código de producto. 30180536
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30180536

Marca: Invitrogen™ RP99385

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82230 (PA5-82230. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P-selectin (Selectin P, GMP-140, LECAM3, CD62 antigen-like family member) is a 140 kDa type 1 transmembrane glycoprotein, and is one of the most commonly studied proteins that regulate cell rolling. P-selectin is stored in the Weibel-Palade bodies of endothelial cells, as well as in a-granules of platelets. From there, it can be rapidly brought to the cell surface after exposure to thrombin, histamine, complement 5a, Ca21 ionophores, or adenosine diphosphate. P-selectin protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. P-selectin plays an important role in adhesive processes between leucocytes and endothelial cells, and is a calcium dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens found on neutrophils and monocytes. P-selectin is constitutively expressed in inflammation and contributes to atherogenesis, thrombosis and tissue destruction. Clinically, P-selectin is used to distinguish heparin induced thrombocytopenia with and without thrombosis.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P16109
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6403
Nombre Human P-Selectin Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen CD62; CD62 antigen-like family member P; CD62P; CD62P antigen; CD62P; CD62 homolog; FLJ45155; GMP140; GMP-140; GMRP; Granule membrane protein 140; granule membrane protein 140 kDa; granulocyte membrane protein; Grmp; LECAM3; leukocyte-endothelial cell adhesion molecule 3; PADGEM; Platelet activation dependent granule-external membrane protein; platelet alpha-granule membrane protein; PSEL; PSELECT; P-selectin; P-selectin precursor; RP1-86F14.2; selectin P; selectin P (granule membrane protein 140 kDa, antigen CD62); selectin, platelet; Selp
Nombre común P-Selectin (CD62P)
Símbolo de gen SELP
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLW
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado