Learn More
Invitrogen™ Human NOD4 (aa 1688-1783) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107006
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66325 (PA5-66325. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
NOD4 is a member of the NOD (nucleotide-binding oligomerization domain) family, a group of proteins that are involved in innate immune defense. NOD4 contains a CARD-like domain, a central NOD domain and a large LRR region. NOD4, an IFN-gamma-inducible nuclear protein, plays a role in homeostatic control of innate immunity and in antiviral defense mechanisms. As a key negative regulator of NF-kappa-B and type I interferon signaling, NOD4 may be a useful target for manipulating immune responses against infectious or inflammation-associated diseases, including cancer.
Especificaciones
Q86WI3 | |
Blocking Assay, Control | |
84166 | |
100 μL | |
AI451557; AK220210; Caterpiller protein 16.1; CLR16.1; copine II; Cpne2; NLR family CARD domain containing 5; NLR family, CARD domain containing 5; Nlrc5; NOD27; NOD4; NOD-like receptor C5; Nucleotide-binding oligomerization domain protein 27; Nucleotide-binding oligomerization domain protein 4; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 5; nucleotide-binding oligomerization domains 27; protein NLRC5 | |
NLRC5 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human NOD4 (aa 1688-1783) Control Fragment | |
RUO | |
NOD4 | |
Unconjugated | |
Recombinant | |
QHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELPLLRQIDLVSCKIDNQTAKLLTSSFTSCPALEVILLSWNLLGDE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.