missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30201069

Invitrogen™ Human NOD4 (aa 1688-1783) Control Fragment Recombinant Protein

Código de producto. 30201069
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30201069 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201069

Marca: Invitrogen™ RP107006

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66325 (PA5-66325. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOD4 is a member of the NOD (nucleotide-binding oligomerization domain) family, a group of proteins that are involved in innate immune defense. NOD4 contains a CARD-like domain, a central NOD domain and a large LRR region. NOD4, an IFN-gamma-inducible nuclear protein, plays a role in homeostatic control of innate immunity and in antiviral defense mechanisms. As a key negative regulator of NF-kappa-B and type I interferon signaling, NOD4 may be a useful target for manipulating immune responses against infectious or inflammation-associated diseases, including cancer.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q86WI3
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 84166
Nombre Human NOD4 (aa 1688-1783) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI451557; AK220210; Caterpiller protein 16.1; CLR16.1; copine II; Cpne2; NLR family CARD domain containing 5; NLR family, CARD domain containing 5; Nlrc5; NOD27; NOD4; NOD-like receptor C5; Nucleotide-binding oligomerization domain protein 27; Nucleotide-binding oligomerization domain protein 4; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 5; nucleotide-binding oligomerization domains 27; protein NLRC5
Nombre común NOD4
Símbolo de gen NLRC5
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELPLLRQIDLVSCKIDNQTAKLLTSSFTSCPALEVILLSWNLLGDE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.