missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30197074

Invitrogen™ Human NOC3L (aa 95-170) Control Fragment Recombinant Protein

Código de producto. 30197074
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30197074 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197074

Marca: Invitrogen™ RP105433

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66939 (PA5-66939. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GADD 153, a growth arrest and DNA damage-inducible gene, encodes a C/EBP-related nuclear protein. This protein has also been designated C/EBP-homologous protein (CHOP-10 or C/EBP zeta). GADD 153 expression is induced by a variety of cellular stresses, inducing nutrient deprivation and metabolic perturbations. GADD 153 functions to block cells in G1 to S phase during cell cycle progression and acts by dimerizing with other C/EBP proteins to direct GADD 153 dimers away from 'classical' C/EBP binding sites, recognizing instead unique 'nonclassical' sites. Thus, GADD 153 acts as a negative modulator of C/EBP-like proteins in certain terminally differentiated cells. GADD 153 belongs to the CBF/MAK21 family, which also includes NOC2L, NOC3L and NOC4L. NOC3L, also designated factor for adipocyte differentiation 24 or Fad24, promotes adipogenesis by controlling DNA replication during the early stages of mitotic clonal expansion (MCE).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8WTT2
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 64318
Nombre Human NOC3L (aa 95-170) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AD24; AF233884; C10orf117; factor for adipocyte differentiation 24; Fad24; NOC3 like DNA replication regulator; NOC3 protein homolog; NOC3L; NOC3L DNA replication regulator; NOC3-like DNA replication regulator; NOC3-like protein; nucleolar complex associated 3 homolog; nucleolar complex associated 3 homolog (S. cerevisiae); nucleolar complex protein 3 homolog; Nucleolar complex-associated protein 3-like protein; RGD1560656
Nombre común NOC3L
Símbolo de gen NOC3L
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia DDLQLMKDLGQRVSFLTRDLSSSEPVHAKKRKHERIIDKYEKIPRTLQTAPEKELIHLLPIKDKSGIIPQTREKPV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.