missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NLRC4 (aa 756-889) Control Fragment Recombinant Protein

Código de producto. 30201072
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30201072 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201072

Marca: Invitrogen™ RP89236

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NLRC4 encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9NPP4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 58484
Nombre Human NLRC4 (aa 756-889) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 9530011P19Rik; AIFEC; CARD, LRR, and NACHT-containing protein; Card12; caspase recruitment domain family, member 12; caspase recruitment domain-containing protein 12; CLAN; Clan protein; CLAN1; CLANA; CLANB; CLANC; CLAND; CLR2.1; FCAS4; ice protease-activating factor; ICE-protease activating factor; ipaf; NLR family CARD domain containing 4; NLR family CARD domain-containing protein 4; NLR family, CARD domain containing 4; NLRC4; NOD-like receptor C4; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 4; UNQ6189/PRO20215
Nombre común NLRC4
Símbolo de gen Nlrc4
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TDSLGNLKNLTKLIMDNIKMNEEDAIKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKILAQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.