missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Nkx2.6 (aa 2-71) Control Fragment Recombinant Protein

Código de producto. 30194659
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30194659 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194659

Marca: Invitrogen™ RP110031

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144733 (PA5-144733. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the NK-2 family of homeodomain proteins are key regulators of growth and development in several tissues, including brain, heart and pancreas.Nkx-2.5, also designated cardiac specific homeobox protein (Csx), is a homolog of the Drosophila tinman protein and is essential for normal cardiovascular development. Expression of Nkx-2.5 during cardiomyogenesis is required for cardiac septation, in which a single atrium and ventricle are separated into four chambers. Nkx-2.5 binds to DNA as a monomer, a homodimer or as a heterodimer with Nkx-2.3 or Nkx-2.6, which suggests that the specific protein-protein interactions of Nkx-2.5 are involved in its transcriptional regulatory function. Nkx-2.6, also a homolog of the Drosophila tinman protein, is expressed in the caudal pharyngeal pouches,the caudal heart progenitors, the sinus venosus, the outflow tract of the heart and in a short segment of the gut between stages E8.5 and E10.5 of embryogenesis. Expression of Nkx-2.6 overlaps with that of Nkx-2.5 in the pharynx and heart. However, Nkx-2.6 mutant mice are viable and fertile, which suggests that Nkx-2.6 plays a compensatory function to Nkx-2.5.
TRUSTED_SUSTAINABILITY

Spécification

Número de acceso A6NCS4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 137814
Nombre Human Nkx2.6 (aa 2-71) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AV044928; CS x 2; CTHM; Drosophila NK2 transcription factor related, locus 6; homeobox protein NK2 homolog F; homeobox protein NK-2 homolog F; homeobox protein NK x 2.6; homeobox protein Nkx-2.6; NK2 homeobox 6; NK2 transcription factor related, locus 6; Nk x 2.6; Nkx-2.6; Nk x 2-6; Nk x 2 f; NK x 4-2; tinman; tinman paralog; Tix
Nombre común Nkx2.6
Símbolo de gen NKX2-6
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LLSPVTSTPFSVKDILRLERERSCPAASPHPRVRKSPENFQYLRMDAEPRGSEVHNAGGGGGDRKLDGSE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.