missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212281

Invitrogen™ Human NF1 (aa 1023-1061) Control Fragment Recombinant Protein

Código de producto. 30212281
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30212281 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212281

Marca: Invitrogen™ RP109759

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145113 (PA5-145113. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in the gene are associated with a coagulation defect. Using positional cloning, the gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P21359
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4763
Nombre Human NF1 (aa 1023-1061) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AW494271; DKFZp686J1293; E030030H24Rik; FLJ21220; neurofibromatosis 1; Neurofibromatosis type 1; neurofibromatosis-related protein NF-1; Neurofibromin; neurofibromin 1; Neurofibromin truncated; NF1; Nf-1; NFNS; VRNF; WSS
Nombre común NF1
Símbolo de gen NF1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.