missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30195934

Invitrogen™ Human NENF (aa 105-164) Control Fragment Recombinant Protein

Código de producto. 30195934
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30195934 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30195934 Proveedor Invitrogen™ N.º de proveedor RP94159

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55875 (PA5-55875. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NENF is a secreted protein that is expressed in neurons but not glial cells of the brain. This protein has neurotrophic activity in primary cultured mouse neurons but not mitogenic activity in primary cultured mouse astrocytes. NENF activated mitogen-activated protein (MAP) and phosphotidylinositol-3 kinase pathways and could be inhibited by pertussis toxin but not receptor tyrosine kinases, suggesting that NENF acts through a Gi/Go-protein-coupled receptor.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UMX5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 29937
Nombre Human NENF (aa 105-164) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1110060M21Rik; cell growth-inhibiting protein 47; cell immortalization-related protein 2; CIR2; NENF; nenf {ECO:0000250; Neudesin; neudesin neurotrophic factor; neuron derived neurotrophic factor; neuron-derived neurotrophic factor; Protein GIG47; SCIRP10; SCIRP10-related protein; secreted protein of unknown function; sp2; SP2 protein; Spinal cord injury related protein 10; spinal cord injury-related protein 10; SPUF; SPUF protein; UniProtKB:Q9CQ45}; wu:fa11a04; wu:fb73f07; zgc:112953; zgc:112953 protein; zgc:152703
Nombre común NENF
Símbolo de gen NENF
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.