missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30211429

Invitrogen™ Human NDUFB11 (aa 110-153) Control Fragment Recombinant Protein

Código de producto. 30211429
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30211429 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30211429 Proveedor Invitrogen™ N.º de proveedor RP95188

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56449 (PA5-56449. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDUFB11 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. NDUFB11 functions in the transfer of electrons from NADH to the respiratory chain and is located in the inner mitochondrial membrane. The immediate electron acceptor for NDUFB11 is believed to be ubiquinone. Further, NDUFB11 is believed to have NADH dehydrogenase activity, and oxidoreductase activity. Diseases associated with NDUFB11 protein dysfunction include linear skin defects with multiple congenital anomalies and mitochondrial complex I deficiency.
TRUSTED_SUSTAINABILITY

Specifications

Número de acceso Q9NX14
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 54539
Nombre Human NDUFB11 (aa 110-153) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen CI-ESSS; complex I NP17.3 subunit; complex I-ESSS; D5Bwg0566e; D5Bwg0577e; ESSS; LSDMCA3; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3 kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; NADH:ubiquinone oxidoreductase subunit B11; NADH-ubiquinone oxidoreductase ESSS subunit; NDUFB11; Neuronal protein 15.6; neuronal protein 17.3; Np15; NP15.6; Np17.3; nuclear protein 15.6; p15.6; P17.3; RGD1563698; UNQ111/PRO1064
Nombre común NDUFB11
Símbolo de gen NDUFB11
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.