missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30204541

Invitrogen™ Human NCK2 (aa 210-290) Control Fragment Recombinant Protein

Código de producto. 30204541
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30204541 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30204541 Proveedor Invitrogen™ N.º de proveedor RP88615

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83174 (PA5-83174. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The NCK family of SH2/SH3 adaptor proteins consists of two members, NCK1 and NCK2, which couple tyrosine kinase signaling, including the EGF and PDGF receptor-pathways, to downstream signaling proteins. The NCK2 protein binds human PDGFR-b (Tyr-1009); overexpression of NCK2 inhibits PDGF-induced membrane ruffling and lamellipod formation.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O43639
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 8440
Nombre Human NCK2 (aa 210-290) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 4833426I10Rik; cytoplasmic protein NCK2; Grb4; growth factor receptor-bound protein 4; NCK adaptor protein 2; NCK2; Nck-2; NCKbeta; non-catalytic region of tyrosine kinase adaptor protein 2; noncatalytic region of tyrosine kinase, beta; SH2/SH3 adaptor protein NCK-beta
Nombre común NCK2
Símbolo de gen NCK2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.