missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MYBBP1A (aa 104-234) Control Fragment Recombinant Protein

Código de producto. 30202713
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30202713 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202713

Marca: Invitrogen™ RP102516

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Myb family of transcription factors, which includes the structurally related A-, B-, and c-Myb genes, regulate differentiation, cellular growth and transactivating gene expression. c-Myb plays an essential role in controlling the proliferation and differentiation of hematopoietic cells, cellular levels of c-Myb decreasing as cells reach terminal differentiation. Myb-binding protein 1A (MYBBP1A) is a novel nuclear protein localized predominantly, but not exclusively, in nucleoli. Although initially isolated as a c-Myb-interacting protein, MYBBP1A is expressed ubiquitously, and associates with a number of different transcription factors. MYBBP1A associates with the aromatic hydrocarbon receptor (AhR), enhancing transactivation and increasing AhR-dependent gene expression. MYBBP1A is a powerful negative regulator of PPAR gamma coactivator 1 alpha (PGC-1 alpha) by p38 MAPK and also acts as a nucleocytoplasmic shuttling protein that utilizes CRM1-dependent and independent nuclear export pathways.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9BQG0
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10514
Nombre Human MYBBP1A (aa 104-234) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AL024407; AU019902; DBP; MYB binding protein 1 A; MYB binding protein (P160) 1 A; MYB binding protein 1 A; myb-binding protein 1 A; Myb-binding protein of 160 kDa; MYBBP1A; nuclear protein P160; P160; p160MBP; p53-activated protein-2; p67MBP; PAP2; PAR interacting protein; PAR-interacting protein; PIP
Nombre común MYBBP1A
Símbolo de gen MYBBP1A
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.