missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MUC1 Control Fragment Recombinant Protein

Código de producto. 30210312
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30210312

Marca: Invitrogen™ RP102279

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MUC1 (Mucin 1, Episialin, MAM-6, CA 15-3, PEM and EMA) is a large cell surface mucin glycoprotein expressed by most glandular and ductal epithelial cells and some hematopoietic cell lineages. MUC1 is a transmembrane glycoprotein with a large mucin-like extracellular domain that matures through several intermediate forms generated by proteolysis, and sequential addition and processing of numerous O-linked glycans that are heavily sialylated. MUC1 is highly polymorphic and each allele encodes a product that contains a different number of repeats (between 30 and 90) leading to large differences in molecular weight of the protein. MUC1 is expressed on most secretory epithelium, including mammary gland and some hematopoietic cells, and is expressed abundantly in >90% breast carcinomas and metastases. Transgenic MUC1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands. The MUC1 gene contains seven exons and produces several different alternatively spliced variants. Overexpression, aberrant intracellular localization, and changes in glycosylation of the MUC1 protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of the MUC1 gene have been reported, but the full-length nature of only some has been determined. Transgenic MUC-1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P15941
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4582
Nombre Human MUC1 Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ADMCKD; ADMCKD1; Breast carcinoma-associated antigen DF3; CA 15-3; Cancer antigen 15-3; carcinoma-associated mucin; CD227; DF3 antigen; EMA; Episialin; H23 antigen; H23AG; J19; KL-6; Krebs von den Lungen-6; MAM6; MCD; MCKD; MCKD1; Medullary cystic kidney disease, autosomal dominant; Muc1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; MUC1-alpha; MUC1-beta; MUC1-CT; MUC1-NT; mucin 1, cell surface associated; mucin 1, transmembrane; Mucin1; mucin-1; Mucin-1 subunit alpha; Mucin-1 subunit beta; peanut-reactive urinary mucin; PEM; PEMT; Polymorphic epithelial mucin; PUM; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen; Tumor-associated mucin
Nombre común MUC1
Símbolo de gen MUC1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado