missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MTBP (aa 800-889) Control Fragment Recombinant Protein

Código de producto. 30210120
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30210120

Marca: Invitrogen™ RP106293

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MTBP inhibits cell migration in vitro and suppresses the invasive behavior of tumor cells. The protein may play a role in MDM2-dependent TP53/p53 homeostasis in unstressed cells. The protein inhibits autoubiquitination of MDM2, thereby enhancing MDM2 stability. This promotes MDM2-mediated ubiquitination of TP53/p53 and its subsequent degradation.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96DY7
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 27085
Nombre Human MTBP (aa 800-889) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI429604; hdm2; HDMX; hMTBP; MDM2 (mouse double minute 2)-binding protein, 104 kD; MDM2 binding protein; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein binding protein, 104 kDa; Mdm2, transformed 3T3 cell double minute p53 binding protein; mdm2-binding protein; MDM2BP; MGC5370; MGC71221; mMTBP; Mtbp; RGD1565672
Nombre común MTBP
Símbolo de gen Mtbp
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PKLATKTSSGQKSMHESKTSRQIKESRSQKHTRILKEVVTETLKKHSITETHECFTACSQRLFEISKFYLKDLKTSRGLFEEMKKTANNN
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado