missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212701

Invitrogen™ Human MICB (aa 331-381) Control Fragment Recombinant Protein

Código de producto. 30212701
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212701

Marca: Invitrogen™ RP107349

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66698 (PA5-66698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MICB encodes the highly polymorphic MHC (HLA) class I chain-related gene B. The protein product is expressed on the cell surface. It is thought that MICB functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. MICB is broadly recognized by NK cells and T cells with NKG2D receptor on their surface. The complex NKG2D-MICB results in MICB expressing cytolytic T cells and NK cells against epithelial tumor cells.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q29980
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4277
Nombre Human MICB (aa 331-381) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen MHC class I chain-related protein B; MHC class I mic-B antigen; MHC class I polypeptide-related sequence B; MHC class I-like located near the LRC, 2; MHC class I-like molecule PERB11.2-IMX; MHC I like leukocyte 2; MICB; MIC-B; Mill2; Mill2 gene for MHC class I-like located near the LRC, 2, exon 3, partial cds, strain:LEW0.1 Lm1; PERB11.2; sMICB; soluble MICB; stress inducible class I homolog
Nombre común MICB
Símbolo de gen MICB
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado