missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30201867

Invitrogen™ Human MICAL2 (aa 1441-1522) Control Fragment Recombinant Protein

Código de producto. 30201867
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201867

Marca: Invitrogen™ RP102879

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58967 (PA5-58967. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MICALs (Molecules Interacting with CasL) are atypical multidomain flavoenzymes with diverse cellular functions. There are three known isoforms, MICAL1, MICAL2 and MICAL3, as well as the MICAL-like proteins MICAL-L1 and MICAL-L2. MICAL2 has three conserved domains: an N-terminal flavin adenine dinucleotide (FAD) binding domain, a calponin homology (CH) domain and a Lin11, Isl-1 and Mec-3 (LIM) domain. It has been demonstrated that MICAL2 could regulate actin stress fibers and is required for normal actin organization. In addition, MICAL2-PV, a novel splicing variants of MICAL2, has been reported to be involved in cancer progression of prostate cancer.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O94851
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9645
Nombre Human MICAL2 (aa 1441-1522) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen [F-actin]-monooxygenase MICAL2; 5330438E18Rik; 9530064J02; flavoprotein oxidoreductase MICAL2; Kiaa0750; Mical2; MICAL-2; MICAL2PV1; MICAL2PV2; microtubule associated monooxygenase, calponin and LIM domain containing 2; microtubule associated monoxygenase, calponin and LIM domain containing 2; mKIAA0750; mMical2; molecule interacting with CasL protein 2; protein MICAL-2; protein-methionine sulfoxide oxidase MICAL2; RGD1311773
Nombre común MICAL2
Símbolo de gen Mical2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KKLVLTQEQKTMLLDWNDSIPESVHLKAGERISQKSAENGRGGRVLKPVRPLLLPRAAGEPLPTQRGAQEKMGTPAEQAQGE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado