missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MFAP1 (aa 250-387) Control Fragment Recombinant Protein

Código de producto. 30206370
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30206370 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30206370

Marca: Invitrogen™ RP90794

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-139758 (PA5-139758, PA5-59958 (PA5-59958. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MFAP1 is a component of the elastin-associated microfibrils. Microfibrils, found either in association with elastin or independently, are an important component of the extracellular matrix of many tissues. MFAP1 is one of a number of proteins demonstrated to be essential for cell division.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P55081
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4236
Nombre Human MFAP1 (aa 250-387) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 4432409M24Rik; Mfap1; Mfap1a; Mfap1b; microfibril associated protein 1; microfibrillar associated protein 1; microfibrillar-associated protein 1; microfibrillar-associated protein 1 A; Microfibrillar-associated protein 1 B; microfibrillar-associated protein 1-like protein; RGD1562232; Spliceosome B complex protein MFAP1; Spliceosome B complex protein MFAP1A; Spliceosome B complex protein MFAP1B
Nombre común MFAP1
Símbolo de gen MFAP1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.