missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MEI1 (aa 588-670) Control Fragment Recombinant Protein

Código de producto. 30211366
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30211366 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30211366

Marca: Invitrogen™ RP95369

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61916 (PA5-61916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The predominant cause of spermatogenic arrest of meiosis is the failure of homologous chromosomes to accurately synapse. MEI1 (Meiosis inhibitor protein 1), also designated Meiosis defective protein 1, is a 1274 amino acid protein that is likely required for the formation of genetically programmed double-strand breaks, the first step in the initiation of meiosis. With predominant expression in testis, it is likely that defects of the gene encoding MEI1 results in male infertility. Interestingly, studies show that genetic variation in the MEI gene possibly predisposes European Americans but not Israeli men to infertility by meiotic arrest. Human MEI1 shares 79% sequence similarity with its mouse homolog. There are seven isoforms of MEI1 that are produced as a result of alternative splicing events.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q5TIA1
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 150365
Nombre Human MEI1 (aa 588-670) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 4932408F18Rik; MEI1; meiosis defective 1; meiosis defective protein 1; meiosis inhibitor 1; meiosis inhibitor protein 1; meiotic double-stranded break formation protein 1; SPATA38; spermatogenesis associated 38
Nombre común MEI1
Símbolo de gen MEI1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia HMKEKFSKKLASSSFIRLTLELKARFCSGLSHSALNQVCSNFLYYMCLNLLSAPEKTGPPSKEELSAVSELLQHGLPQISSRS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.