missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30197095

Invitrogen™ Human MED14 (aa 1348-1427) Control Fragment Recombinant Protein

Código de producto. 30197095
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30197095 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197095

Marca: Invitrogen™ RP107314

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66666 (PA5-66666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O60244
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9282
Nombre Human MED14 (aa 1348-1427) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 9930001L01Rik; Activator-recruited cofactor 150 kDa component; ARC150; AU041628; Cofactor required for Sp1 transcriptional activation subunit 2; cofactor required for Sp1 transcriptional activation subunit 2 (150 kDa); cofactor required for Sp1 transcriptional activation, subunit 2; cofactor required for Sp1 transcriptional activation, subunit 2 (150 kD); CRSP complex subunit 2; CRSP150; CRSP2; CSRP; CXorf4; DRIP150; ENSMUSG00000073278; EXLM1; Gm641; hRGR1; human homolog of yeast RGR1; MED14; Mediator complex subunit 14; mediator of RNA polymerase II transcription subunit 14; MGC104513; ORF1; RGD1560170; RGR1; RGR1 homolog; thyroid hormone receptor-associated protein complex 170 kDa component; thyroid hormone receptor-associated protein complex component TRAP170; Transcriptional coactivator CRSP150; transcriptional co-activator CRSP150; TRAP170; vitamin D receptor-interacting protein complex component DRIP150; vitamin D3 receptor-interacting protein complex 150 kDa component
Nombre común MED14
Símbolo de gen Med14
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.