missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30200359

Invitrogen™ Human MCM2 (aa 393-483) Control Fragment Recombinant Protein

Código de producto. 30200359
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30200359 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200359

Marca: Invitrogen™ RP95258

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111023 (PA5-111023. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MCM2 (Mini chromosome maintenance protein 2) is involved in regulating DNA replication. MCM2 (also called CDCL1, mitotin and BM28), is a human nuclear protein that is crucial in the cell cycle, being involved in the onset of DNA replication and cell division. It is similar to members of the family of early S-phase proteins. MCM2 has been mapped to 3q21. From its localization, CDCL1 became a candidate for an oncogene affected by chromosomal breaks in acute myeloid leukemia (AML).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P49736
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4171
Nombre Human MCM2 (aa 393-483) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AA959861; AW476101; BM28; CCNL1; cdc19; CDCL1; cell devision cycle-like 1; cyclin-like 1; D3S3194; DFNA70; DNA replication licensing factor MCM2; Kiaa0030; MCM DNA helicase complex subunit MCM2; Mcm2; Mcmd2; MGC10606; mini chromosome maintenance deficient 2; minichromosome maintenance complex component 2; minichromosome maintenance deficient 2 (mitotin); minichromosome maintenance deficient 2 mitotin; minichromosome maintenance deficient 2 mitotin (S. cerevisiae); Minichromosome maintenance protein 2; Minichromosome maintenance protein 2 homolog; MITOTIN; mKIAA0030; Nuclear protein BM28; YBL023C; YBL0438
Nombre común MCM2
Símbolo de gen MCM2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.