missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MATK (aa 196-266) Control Fragment Recombinant Protein

Código de producto. 30213221
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30213221 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30213221 Proveedor Invitrogen™ N.º de proveedor RP109106

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MATK (Hyl) is a non-receptor CSK-type protein tyrosine kinase that is thought to function in signal transduction pathways important in megakaryocyte growth and/or differentiation. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P42679
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4145
Nombre Human MATK (aa 196-266) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Batk; CHK; Csk homologous kinase; Csk-homologous kinase; Csk-type protein tyrosine kinase; CTK; DKFZp434N1212; Hematopoietic consensus tyrosine-lacking kinase; HHYLTK; hydroxyaryl-protein kinase; HYL; HYL tyrosine kinase; HYLTK; leukocyte carboxyl-terminal src kinase related; Lsk; Matk; megakaryocyte-associated tyrosine kinase; megakaryocyte-associated tyrosine kinase (non-receptor protein tyrosine kinase); megakaryocyte-associated tyrosine-protein kinase; MGC1708; MGC2101; non-receptor protein kinase protein; Ntk; Protein kinase BATK; protein kinase HYL; Protein kinase NTK; tyrosine kinase MATK; tyrosine-protein kinase CTK; tyrosylprotein kinase
Nombre común MATK
Símbolo de gen MATK
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.