missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MARVELD2 (aa 363-442) Control Fragment Recombinant Protein

Código de producto. 30202314
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30202314 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202314

Marca: Invitrogen™ RP105204

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tight junctions form an important barrier of paracellular transport in epithelial cells. Sealing of two adjacent cells at bicellular tight junctions, a point where three adjacent cells are in contact with each other. Tricellulin is the first protein identified that specifically concentrates in tricellular tight junctions. This protein has four membrane spanning domains, similarly to claudins. Tricellulin expression is high in epithelium-derived tissues, such as small intestine, kidney and lung. Functional evidence for the role of tricellulin in tight junction formation comes from siRNA studies, where suppression of its expression leads to compromised epithelial barrier and tight junction formation. Loss of function in tricellulin mutants missing all or most of a conserved region in the cytosolic domain which binds to the cytosolic scaffolding protein ZO-1, indicate that interaction with other known tight junction proteins plays an important role for the function of tricellulin.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8N4S9
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 153562
Nombre Human MARVELD2 (aa 363-442) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen BC003296; DFNB49; MARVD2; MARVEL (membrane-associating) domain containing 2; MARVEL domain containing 2; MARVEL domain-containing protein 2; Marveld2; Mrvldc2; Tric; Trica; Tricb; Tricc; Tricellulin
Nombre común MARVELD2
Símbolo de gen MARVELD2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDY
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.